CJC-1295 Without DAC Muscle Building 863288-34-0 Peptide Human Growth
CJC-1295 Without DAC Muscle Building 863288-34-0 Peptide Human Growth
Get bigger, stronger muscles with CJC-1295 Without DAC Muscle Building Peptide Human Growth. We are a factory specializing in high-quality performance enhancers.
Packing size: 1g;5g;10g;50g;100g;1kg Foil bags; 25kg Drums Customized packing available
Express(3-8 days)
DHL/TNT/Fedex
By Air(8-15 days)
To airport only,customer deal with customs clearance in destination airport ;Suitable for large quantity like 50kg to hundreds of kgs
Door to door(8-15days)
Most efficient way under 100kg Special line service
By Sea(20-40 days)
To seaport only,customer deal with customs clearance in destination seaport; Suitable for large goods,hundreds of kgs to container;Cheaper but longer time.
Q: What's your MOQ ? A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.Q: Is there a discount ? A: Yes, for larger quantity, we always support with better price.Q: How to confirm the Product Quality before placing orders ? A: You can get free samples for some proucts, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests, we will manufacture the products according to your requests.Q: How to start orders or make payments ? A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.Q: How do you treat quality complaint ? A: First of all, our quality control will reduce the quality problem to near zero. If there is a quality problem caused by us, we will send you free goods for replacement or refund your loss.
Product Name
CJC1295
Synonyms
CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG)
CAS
863288-34-0
MF
C152H252N44O42
MW
3367.89688
EINECS
206-141-6
Melting point
> 177° C (dec.)
density
1.45
storage temp.
-20°C Freezer, Under inert atmosphere
solubility
Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
Q: What's your MOQ ? A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg. Q: Is there a discount ? A: Yes, for larger quantity, we always support with better price. Q: How to confirm the Product Quality before placing orders ? A: You can get free samples for some proucts, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests, we will manufacture the products according to your requests. Q: How to start orders or make payments ? A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly. Q: How do you treat quality complaint ? A: First of all, our quality control will reduce the quality problem to near zero. If there is a quality problem caused by us, we will send you free goods for replacement or refund your loss.
